Tested Applications
Positive WB detected in | HepG2 cells, SMMC-7721 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25152-1-AP targets ZNF253 in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18570 Product name: Recombinant human ZNF253 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 63-130 aa of BC125063 Sequence: LTMERHEMIAKPPVMSSHFAQDLWPENIQNSFQIGMLRRYEECRHDNLQLKKGCKSVGEHKVHKGGYN Predict reactive species |
Full Name | zinc finger protein 253 |
Calculated Molecular Weight | 499 aa, 58 kDa |
Observed Molecular Weight | 58-65 kDa |
GenBank Accession Number | BC125063 |
Gene Symbol | ZNF253 |
Gene ID (NCBI) | 56242 |
RRID | AB_2879927 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O75346 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ZNF253, also named as Zinc finger protein 411 or BMZF1, is a 499 amino acid protein, which contains one KRAB domain and eleven C2H2-type zinc fingers. ZNF253 belongs to the krueppel C2H2-type zinc-finger protein family and is expressed in bone marrow and in monocytic and immature erythroid cell lines. ZNF253 may function as a transcription factor.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ZNF253 antibody 25152-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |