ZNF280A Polyclonal antibody

• 

  WB analysis using 31903-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31903-1-AP (ZNF280A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 31903-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31903-1-AP (ZNF280A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

ZNF280A Polyclonal Antibody for WB, ELISA

Cat No. 31903-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Zinc finger protein 636, Zinc finger protein 280A, Zinc Finger Protein 280, Suppressor of hairy wing homolog 1, SUHW1

---

Tested Applications

• Positive WB detected in: K-562 cells, mouse adrenal gland tissue, mouse kidney tissue, rat kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31903-1-AP targets ZNF280A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35942

  Product name: Recombinant human ZNF280A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 461-542 aa of BC053901

  Sequence: LTLKEEIEHKTKDHQTFKKPEQLQGLPSETKVIIQTSVQPGSSGMASVIVSNTDPQSSPVKTKKKTAMNTRDSRLPCSKDSS

• Full Name: zinc finger protein 280A
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC053901
• Gene Symbol: ZNF280A
• Gene ID (NCBI): 129025
• RRID: AB_3670138
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P59817
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Zinc finger proteins are the largest transcription factor family in the human genome and play a significant role in regulating and managing gene expression, including development, differentiation, metabolism, and autophagy (PMID: 18253864; 27411336). Zinc finger protein 280A (ZNF280A, also known as SUHW1, ZNF280, and ZNF636) is a member of the zinc-finger protein family, carrying two consecutive Cys2His2 zinc finger domains (PMID: 33414445). Cys2-His2 (C2H2) zinc finger domains (ZFs) were originally identified as DNA-binding domains, and uncharacterized domains are typically assumed to function in DNA binding (PMID: 18253864).