Tested Applications
Positive WB detected in | HEK-293 cells, L02 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24882-1-AP targets ZNF320 in WB, ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21688 Product name: Recombinant human ZNF320 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 190-238 aa of BC131555 Sequence: KCKVCDKAFKHDSHLAKHTRIHRGDKHYTCNECGKVFDQKATLACHHRS Predict reactive species |
Full Name | zinc finger protein 320 |
Calculated Molecular Weight | 509 aa, 59 kDa |
Observed Molecular Weight | 40-45 kDa |
GenBank Accession Number | BC131555 |
Gene Symbol | ZNF320 |
Gene ID (NCBI) | 162967 |
RRID | AB_2879777 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | A2RRD8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ZNF320 antibody 24882-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |