Product Information
24882-1-PBS targets ZNF320 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21688 Product name: Recombinant human ZNF320 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 190-238 aa of BC131555 Sequence: KCKVCDKAFKHDSHLAKHTRIHRGDKHYTCNECGKVFDQKATLACHHRS Predict reactive species |
| Full Name | zinc finger protein 320 |
| Calculated Molecular Weight | 509 aa, 59 kDa |
| Observed Molecular Weight | 40-45 kDa |
| GenBank Accession Number | BC131555 |
| Gene Symbol | ZNF320 |
| Gene ID (NCBI) | 162967 |
| RRID | AB_2879777 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | A2RRD8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



