ZNF382 Polyclonal antibody

• 

  WB analysis of K-562 using 26560-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 26560-1-AP (ZNF382 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of SW 1990 using 26560-1-AP

  IP result of anti-ZNF382 (IP:26560-1-AP, 4ug; Detection:26560-1-AP 1:500) with SW 1990 cells lysate 2800 ug.

ZNF382 Polyclonal Antibody for WB, IP, ELISA

Cat No. 26560-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, ELISA

Synonyms

KS1, zinc finger protein 382, ZNF382

---

Tested Applications

• Positive WB detected in: K-562 cells
• Positive IP detected in: SW 1990 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

26560-1-AP targets ZNF382 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23348

  Product name: Recombinant human ZNF382 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 130-312 aa of BC132675

  Sequence: TILCEYKPDGKVLKNISELVIRNISPIKEKFGDSTGWGKSLLNTKHEKIHPAVNLHKQTERVLSGKQELIQHQKVQAPEQPFDHNECEKSFLMKGMLFTHTRAHRGERTFEYNKDGIAFIEKSSLSVHPSNLMEKKPSAYNKYGKFLCRKPVFIMPQRPQTEEKPFHCPYCGNNFRRKSYLIE

• Full Name: zinc finger protein 382
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC132675
• Gene Symbol: ZNF382
• Gene ID (NCBI): 84911
• RRID: AB_2880553
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96SR6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Adv Res; Mini and enhanced CRISPR activators for cancer therapies; Authors - Meiyu Huang
human	WB,IHC,IF	Phytomedicine; Andrographolide suppresses the malignancy of pancreatic cancer via alleviating DNMT3B-dependent repression of tumor suppressor gene ZNF382; Authors - Kai-Ru Zhuang