ZNF419 Polyclonal antibody, PBS Only

• 

  WB analysis of A549 using 25724-1-AP (same clone as 25724-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 25724-1-AP (ZNF419 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25724-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 25724-1-AP (same clone as 25724-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25724-1-AP (ZNF419 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25724-1-PBS in a different storage buffer formulation.

ZNF419 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25724-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

25724-1-PBS targets ZNF419 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22802

  Product name: Recombinant human ZNF419 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 161-510 aa of BC008297

  Sequence: SREVGKALLISSGVLKHQVTHTGEKSHRSSKSREAFHAGKRHYKCSECGKAFGQKYLLVQHQRLHAGKKTYECSECGKLFRDMSNLFIHQIVHTGERPYGCSNCGKSFSRNAHLIEHQRVHTGEKPFTCSECGKAFRHNSTLVQHHKIHTGVRPYECSECGKLFSFNSSLMKHQRVHTGERPYKCSECGKFYSHKSNLIKHWRVHTGERPYKCSDCGKFFTQCSSLMQHQKVHTGEKPFKCNECGRFFRENSTLVRHQRVHTGAKPYECRECGKFFSQSSTLMQHRKVHIGEKPFKCNECGRLFRENSSLVKHQRVHTGAKPYECRECGKFFRHNSSLFKHRRIHTGEMQ

• Full Name: zinc finger protein 419
• Calculated Molecular Weight: 510 aa, 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC008297
• Gene Symbol: ZNF419
• Gene ID (NCBI): 79744
• RRID: AB_2880210
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96HQ0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.