ZNF419 Polyclonal antibody

• 

  WB analysis of A549 using 25724-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 25724-1-AP (ZNF419 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 25724-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25724-1-AP (ZNF419 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

ZNF419 Polyclonal Antibody for WB, ELISA

Cat No. 25724-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

zinc finger protein 419, ZNF419, ZNF419A

---

Tested Applications

• Positive WB detected in: A549 cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25724-1-AP targets ZNF419 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22802

  Product name: Recombinant human ZNF419 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 161-510 aa of BC008297

  Sequence: SREVGKALLISSGVLKHQVTHTGEKSHRSSKSREAFHAGKRHYKCSECGKAFGQKYLLVQHQRLHAGKKTYECSECGKLFRDMSNLFIHQIVHTGERPYGCSNCGKSFSRNAHLIEHQRVHTGEKPFTCSECGKAFRHNSTLVQHHKIHTGVRPYECSECGKLFSFNSSLMKHQRVHTGERPYKCSECGKFYSHKSNLIKHWRVHTGERPYKCSDCGKFFTQCSSLMQHQKVHTGEKPFKCNECGRFFRENSTLVRHQRVHTGAKPYECRECGKFFSQSSTLMQHRKVHIGEKPFKCNECGRLFRENSSLVKHQRVHTGAKPYECRECGKFFRHNSSLFKHRRIHTGEMQ

• Full Name: zinc finger protein 419
• Calculated Molecular Weight: 510 aa, 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC008297
• Gene Symbol: ZNF419
• Gene ID (NCBI): 79744
• RRID: AB_2880210
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96HQ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.