Tested Applications
Positive WB detected in | A431 cells, HeLa cells, Jurkat cells, HepG2 cells |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 4 publications below |
IHC | See 1 publications below |
ChIP | See 1 publications below |
Product Information
25299-1-AP targets ZNF460 in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18106 Product name: Recombinant human ZNF460 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 102-211 aa of BC118625 Sequence: MQEYFLRPGTDPQSEKLHGKMSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGENSYKFEEMFNENCFLVQHEQILPRVKPYDCPECGKAFGKSKHL Predict reactive species |
Full Name | zinc finger protein 460 |
Calculated Molecular Weight | 562 aa, 64 kDa |
Observed Molecular Weight | 65 kDa |
GenBank Accession Number | BC118625 |
Gene Symbol | ZNF460 |
Gene ID (NCBI) | 10794 |
RRID | AB_2880016 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q14592 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ZNF460 antibody 25299-1-AP | Download protocol |
IF protocol for ZNF460 antibody 25299-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Autophagy ATG10S promotes IFNL1 expression and autophagic degradation of multiple viral proteins mediated by IFNL1 | ||
Cell Rep Targeting CXCR1 alleviates hyperoxia-induced lung injury through promoting glutamine metabolism | ||
J Cancer Overexpression of ZNF460 predicts worse survival and promotes metastasis through JAK2/STAT3 signaling pathway in patient with colon cancer. | ||
Mol Cancer ZNF460-mediated circRPPH1 promotes TNBC progression through ITGA5-induced FAK/PI3K/AKT activation in a ceRNA manner | ||
Arch Biochem Biophys ZNF460 enhances HADHB level by activating its transcription to promote the progression and pulmonary invasion of cutaneous T cell lymphoma |