ZNF460 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZNF460 Polyclonal antibody (25299-1-AP)

• Featured Product
• KD/KO Validated

ZNF460 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25299-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ChIP, ELISA

Synonyms

ZNF272, Zinc finger protein HZF8, Zinc finger protein 460, Zinc finger protein 272, HZF8

• 

  WB analysis using 25299-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 25299-1-AP (ZNF460 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 25299-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 25299-1-AP (ZNF460 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 25299-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ZNF460 antibody (25299-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ZNF460 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, HeLa cells, Jurkat cells, HepG2 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25299-1-AP targets ZNF460 in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18106

  Product name: Recombinant human ZNF460 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 102-211 aa of BC118625

  Sequence: MQEYFLRPGTDPQSEKLHGKMSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGENSYKFEEMFNENCFLVQHEQILPRVKPYDCPECGKAFGKSKHL

• Full Name: zinc finger protein 460
• Calculated Molecular Weight: 562 aa, 64 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC118625
• Gene Symbol: ZNF460
• Gene ID (NCBI): 10794
• RRID: AB_2880016
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14592
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ZNF460 Polyclonal antibody (Cat# 25299-1-AP) has 12 citations published in journals including Molecular Cancer, Autophagy, Oncogene, Cell Reports, FASEB Journal, Phytomedicine, Cell Reports Medicine, Journal of Biological Chemistry, Journal of Cellular and Molecular Medicine, Cell Biology and Toxicology, Archives of Biochemistry and Biophysics, and Journal of Cancer. Research fields span oncology (TNBC, colorectal, gastric, colon, prostate cancers, cutaneous T-cell lymphoma), autophagy, epigenetics (m6A modification), immune escape, EMT/metastasis, and signaling pathways (FAK/PI3K/AKT, JAK2/STAT3, STING).

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,ChIP	Mol Cancer; ZNF460-mediated circRPPH1 promotes TNBC progression through ITGA5-induced FAK/PI3K/AKT activation in a ceRNA manner; Authors - Chuanpeng Zhang
human	WB	Autophagy; ATG10S promotes IFNL1 expression and autophagic degradation of multiple viral proteins mediated by IFNL1; Authors - Miao-Qing Zhang
human	WB,IF,ChIP	Cell Rep Med; Enalaprilat reverses neutrophil polarization imbalance via targeting taurine-STING axis for treatment of diabetic wounds.; Authors - Li Lu
human,mouse	WB,IF,ChIP	Phytomedicine; Modified Fuzheng Yiliu Decoction chemosensitizes colorectal cancer by inhibiting cancer stem cell metabolism and stemness through CAV1/ZNF460/GRP78 signaling.; Authors - Yuling Xue
human	IHC	Oncogene; M(6)A-dependent upregulation of ZNF460 promotes epithelial-mesenchymal transition and metastasis of gastric cancer through a histone modification-mediated positive feedback loop.; Authors - Ben Yue ; KD Validated
human		Cell Rep; Targeting CXCR1 alleviates hyperoxia-induced lung injury through promoting glutamine metabolism; Authors - Hao Qin