ZNF460 Polyclonal antibody

• 

  WB analysis using 25299-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 25299-1-AP (ZNF460 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25299-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 25299-1-AP (ZNF460 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 25299-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ZNF460 antibody (25299-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

ZNF460 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25299-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ChIP, ELISA

Synonyms

ZNF272, Zinc finger protein HZF8, Zinc finger protein 460, Zinc finger protein 272, HZF8

---

Tested Applications

• Positive WB detected in: A431 cells, HeLa cells, Jurkat cells, HepG2 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IHC: See 1 publications below
• ChIP: See 1 publications below

Product Information

25299-1-AP targets ZNF460 in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18106

  Product name: Recombinant human ZNF460 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 102-211 aa of BC118625

  Sequence: MQEYFLRPGTDPQSEKLHGKMSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGENSYKFEEMFNENCFLVQHEQILPRVKPYDCPECGKAFGKSKHL

• Full Name: zinc finger protein 460
• Calculated Molecular Weight: 562 aa, 64 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC118625
• Gene Symbol: ZNF460
• Gene ID (NCBI): 10794
• RRID: AB_2880016
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14592
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Autophagy; ATG10S promotes IFNL1 expression and autophagic degradation of multiple viral proteins mediated by IFNL1; Authors - Miao-Qing Zhang
human		Cell Rep; Targeting CXCR1 alleviates hyperoxia-induced lung injury through promoting glutamine metabolism; Authors - Hao Qin
human	WB,IHC	J Cancer; Overexpression of ZNF460 predicts worse survival and promotes metastasis through JAK2/STAT3 signaling pathway in patient with colon cancer.; Authors - Tengfei Hao
human	WB,ChIP	Mol Cancer; ZNF460-mediated circRPPH1 promotes TNBC progression through ITGA5-induced FAK/PI3K/AKT activation in a ceRNA manner; Authors - Chuanpeng Zhang
human	WB	Arch Biochem Biophys; ZNF460 enhances HADHB level by activating its transcription to promote the progression and pulmonary invasion of cutaneous T cell lymphoma; Authors - Qian He