Tested Applications
Positive WB detected in | mouse small intestine tissue, PC-3 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24508-1-AP targets ZNF512 in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21602 Product name: Recombinant human ZNF512 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 383-490 aa of BC043221 Sequence: NSVHAEDWFVVNPTTTKSFEKLMKIKQRQQEEEKRRQQHRSRRSLRRRQQPGIELPETELSLRVGKDQRRNNEELVVSASCKEPEQEPVPAQFQKVKPPKTNHKRGRK Predict reactive species |
Full Name | zinc finger protein 512 |
Calculated Molecular Weight | 567 aa, 65 kDa |
Observed Molecular Weight | 66-70 kDa |
GenBank Accession Number | BC043221 |
Gene Symbol | ZNF512 |
Gene ID (NCBI) | 84450 |
RRID | AB_2879580 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96ME7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ZNF512 antibody 24508-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |