Tested Applications
Positive WB detected in | SH-SY5Y cells, A549 cells, HeLa cells, SMMC-7721 cells |
Positive IF/ICC detected in | A549 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25592-1-AP targets ZNF549 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22371 Product name: Recombinant human ZNF549 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 109-236 aa of BC060863 Sequence: CILVMKDILYLSEHQGTLPWQKPYTSVASGKWFSFGSNLQQHQNQDSGEKHIRKEESSALLLNSCKIPLSDNLFPCKDVEKDFPTILGLLQHQTTHSRQEYAHRSRETFQQRRYKCEQVFNEKVHVTE Predict reactive species |
Full Name | zinc finger protein 549 |
Calculated Molecular Weight | 640 aa, 74 kDa |
Observed Molecular Weight | 74 kDa |
GenBank Accession Number | BC060863 |
Gene Symbol | ZNF549 |
Gene ID (NCBI) | 256051 |
RRID | AB_2880147 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q6P9A3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ZNF549 antibody 25592-1-AP | Download protocol |
IF protocol for ZNF549 antibody 25592-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |