ZNF611 Polyclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 17249-1-AP (same clone as 17249-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17249-1-AP (ZNF611 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17249-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 17249-1-AP (same clone as 17249-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17249-1-AP (ZNF611 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17249-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 17249-1-AP (same clone as 17249-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17249-1-AP (ZNF611 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17249-1-PBS in a different storage buffer formulation.

ZNF611 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 17249-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

17249-1-PBS targets ZNF611 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9984

  Product name: Recombinant human ZNF611 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-151 aa of BC000918

  Sequence: MLQRLQIIGESIMKRDLTSVINVANFSEIVHILQVIGELILERNLTNVMTVPRSSVKLHPMQNIGEFIQERNLTSVMIVAKPLLHVHTSLDIRESILDRNLTNVISVARSSVQDHSMQNIRKFIFEITVPNEMSIANHQALIDIGVNSALT

• Full Name: zinc finger protein 611
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 81 kDa
• GenBank Accession Number: BC000918
• Gene Symbol: ZNF611
• Gene ID (NCBI): 81856
• RRID: AB_2242179
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N823
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.