ZNF611 Polyclonal antibody

• 

  WB analysis of HEK-293 using 17249-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17249-1-AP (ZNF611 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 17249-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17249-1-AP (ZNF611 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 17249-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17249-1-AP (ZNF611 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

ZNF611 Polyclonal Antibody for WB, ELISA

Cat No. 17249-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

zinc finger protein 611, ZNF611

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17249-1-AP targets ZNF611 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9984

  Product name: Recombinant human ZNF611 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-151 aa of BC000918

  Sequence: MLQRLQIIGESIMKRDLTSVINVANFSEIVHILQVIGELILERNLTNVMTVPRSSVKLHPMQNIGEFIQERNLTSVMIVAKPLLHVHTSLDIRESILDRNLTNVISVARSSVQDHSMQNIRKFIFEITVPNEMSIANHQALIDIGVNSALT

• Full Name: zinc finger protein 611
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 81 kDa
• GenBank Accession Number: BC000918
• Gene Symbol: ZNF611
• Gene ID (NCBI): 81856
• RRID: AB_2242179
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N823
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.