ZNF639 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 25817-1-AP (same clone as 25817-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 25817-1-AP (ZNF639 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25817-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 25817-1-AP (same clone as 25817-1-PBS)

  IP result of anti-ZNF639 (IP:25817-1-AP, 4ug; Detection:25817-1-AP 1:300) with HeLa cells lysate 3960ug. This data was developed using the same antibody clone with 25817-1-PBS in a different storage buffer formulation.

ZNF639 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 25817-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

25817-1-PBS targets ZNF639 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19854

  Product name: Recombinant human ZNF639 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 136-485 aa of BC026181

  Sequence: EDVPIAVEVHAISEDYDIETENNSSESLQDQTDEEPPAKLCKILDKSQALNVTAQQKWPLLRANSSGLYKCELCEFNSKYFSDLKQHMILKHKRTDSNVCRVCKESFSTNMLLIEHAKLHEEDPYICKYCDYKTVIFENLSQHIADTHFSDHLYWCEQCDVQFSSSSELYLHFQEHSCDEQYLCQFCEHETNDPEDLHSHVVNEHACKLIELSDKYNNGEHGQYSLLSKITFDKCKNFFVCQVCGFRSRLHTNVNRHVAIEHTKIFPHVCDDCGKGFSSMLEYCKHLNSHLSEGIYLCQYCEYSTGQIEDLKIHLDFKHSADLPHKCSDCLMRFGNERELISHLPVHETT

• Full Name: zinc finger protein 639
• Calculated Molecular Weight: 485 aa, 56 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC026181
• Gene Symbol: ZNF639
• Gene ID (NCBI): 51193
• RRID: AB_2880251
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UID6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNF639, also named as ZASC1, is a 485 amino acid protein, which locates in the nucleus and contains 8 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF639 binds DNA and may function as a transcriptional repressor.