ZNF649 Polyclonal antibody

• 

  WB analysis of HL-60 using 25797-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 25797-1-AP (ZNF649 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25797-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25797-1-AP (ZNF649 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 25797-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 25797-1-AP (ZNF649 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

ZNF649 Polyclonal Antibody for WB, ELISA

Cat No. 25797-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Zinc finger protein 649

---

Tested Applications

• Positive WB detected in: COLO 320 cells, HL-60 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25797-1-AP targets ZNF649 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22700

  Product name: Recombinant human ZNF649 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 66-183 aa of BC005368

  Sequence: LWTLEDEIHSPAHPEIEKADDHLQQPLQNQKILKRTGQRYEHGRTLKSYLGLTNQSRRYNRKEPAEFNGDGAFLHDNHEQMPTEIEFPESRKPISTKSQFLKHQQTHNIEKAHECTDC

• Full Name: zinc finger protein 649
• Calculated Molecular Weight: 505 aa, 58 kDa
• Observed Molecular Weight: 50-57 kDa
• GenBank Accession Number: BC005368
• Gene Symbol: ZNF649
• Gene ID (NCBI): 65251
• RRID: AB_2880241
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BS31
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZNF649, also named as Zinc finger protein 649, is a 505 amino acid protein, which contains The one KRAB domain and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF649 is highly expressed in heart, skeletal muscle, and brain and lower expression in liver, lung, kidney, pancreas and placenta. ZNF649 as a regulator of transcriptional factor complexes may suppress SRE and AP-1 transcription activities by growth factor signaling pathways.