Tested Applications
| Positive IP detected in | mouse liver tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29317-1-AP targets ZNF664 in IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30992 Product name: Recombinant human ZNF664 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 50-100 aa of BC101530 Sequence: WRDHTGEKVYKCDDCGKDFSTTTKLNRHKKIHTVEKPYKCYECGKAFNWSS Predict reactive species |
| Full Name | zinc finger protein 664 |
| Calculated Molecular Weight | 261 aa, 30 kDa |
| Observed Molecular Weight | 30-35 kDa |
| GenBank Accession Number | BC101530 |
| Gene Symbol | ZNF664 |
| Gene ID (NCBI) | 144348 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8N3J9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for ZNF664 antibody 29317-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

