Tested Applications
| Positive WB detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25556-1-AP targets ZNF695 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22202 Product name: Recombinant human ZNF695 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 88-133 aa of BC023527 Sequence: LSSYLTEDILPEQGLQVSFQKVMLRRYERCCLEKLRLRNDWEIVAM Predict reactive species |
| Full Name | zinc finger protein 695 |
| Calculated Molecular Weight | 515 aa, 60 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC023527 |
| Gene Symbol | ZNF695 |
| Gene ID (NCBI) | 57116 |
| RRID | AB_2880130 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IW36 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
What published studies show
The ZNF695 Polyclonal antibody (Cat# 25556-1-AP) has 2 citations. They appear in Oncology Reports and Journal of Cancer. The research fields include colorectal cancer cell proliferation via NEK2/PI3K/Akt/mTOR signaling pathways, and prostate adenocarcinoma biomarker identification for early diagnosis based on Gleason score association.
| Species | Application | Title |
|---|---|---|
Oncol Rep Zinc finger protein 695 facilitates the proliferation of colorectal cancer cells through activation of the NEK2 and PI3K/Akt/mTOR signaling pathways
| ||
J Cancer Five-gene signature associating with Gleason score serve as novel biomarkers for identifying early recurring events and contributing to early diagnosis for Prostate Adenocarcinoma. |
Reviews
What customers say
One reviewer (Claire M., January 2026) reported a negative result using this antibody for Western Blot at a 1:300 dilution. The antibody failed to detect ZNF695 in three different cell types: hBJ fibroblasts, MCF7, and HepG2. The reviewer included attached images documenting the lack of signal across all tested samples. Overall, the single review reflects dissatisfaction with the product's performance in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Claire (Verified Customer) (01-13-2026) | This antibody did not detect ZNF695 by western blot in three different cell types - hBJ fibroblasts, MCF7, and HEPG2. Please see attached files for details.
 |
