ZNF695 Polyclonal antibody

• 

  WB analysis of HepG2 using 25556-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 25556-1-AP (ZNF695 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 25556-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 25556-1-AP (ZNF695 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 25556-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 25556-1-AP (ZNF695 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

ZNF695 Polyclonal Antibody for WB, ELISA

Cat No. 25556-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

SBZF3

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

25556-1-AP targets ZNF695 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22202

  Product name: Recombinant human ZNF695 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 88-133 aa of BC023527

  Sequence: LSSYLTEDILPEQGLQVSFQKVMLRRYERCCLEKLRLRNDWEIVAM

• Full Name: zinc finger protein 695
• Calculated Molecular Weight: 515 aa, 60 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC023527
• Gene Symbol: ZNF695
• Gene ID (NCBI): 57116
• RRID: AB_2880130
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IW36
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	J Cancer; Five-gene signature associating with Gleason score serve as novel biomarkers for identifying early recurring events and contributing to early diagnosis for Prostate Adenocarcinoma.; Authors - Lingyu Zhang