Tested Applications
Positive WB detected in | HepG2 cells, HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IHC | See 1 publications below |
Product Information
25556-1-AP targets ZNF695 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22202 Product name: Recombinant human ZNF695 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 88-133 aa of BC023527 Sequence: LSSYLTEDILPEQGLQVSFQKVMLRRYERCCLEKLRLRNDWEIVAM Predict reactive species |
Full Name | zinc finger protein 695 |
Calculated Molecular Weight | 515 aa, 60 kDa |
Observed Molecular Weight | 70 kDa |
GenBank Accession Number | BC023527 |
Gene Symbol | ZNF695 |
Gene ID (NCBI) | 57116 |
RRID | AB_2880130 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8IW36 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ZNF695 antibody 25556-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |