Tested Applications
| Positive WB detected in | mouse brain tissue, mouse testis tissue, PC-3 cells, mouse liver tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 2 publications below |
| IHC | See 1 publications below |
| ChIP | See 1 publications below |
Product Information
25411-1-AP targets ZNF740 in WB, IHC, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22295 Product name: Recombinant human ZNF740 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC053557 Sequence: MAQASLLACEGLAGVSLVPTAASKKMMLSQIASKQAENGERAGSPDVLRCSSQGHRKDSDKSRSRKDDDSLSEASHSKKTVKKVVVVEQN Predict reactive species |
| Full Name | zinc finger protein 740 |
| Calculated Molecular Weight | 193 aa, 22 kDa |
| Observed Molecular Weight | 22-30 kDa |
| GenBank Accession Number | BC053557 |
| Gene Symbol | ZNF740 |
| Gene ID (NCBI) | 283337 |
| RRID | AB_2880065 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NDX6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ZNF740 antibody 25411-1-AP | Download protocol |
| IP protocol for ZNF740 antibody 25411-1-AP | Download protocol |
| WB protocol for ZNF740 antibody 25411-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int J Oncol ZNF740 facilitates the malignant progression of hepatocellular carcinoma via the METTL3/HIF‑1A signaling axis | ||
Cell Death Dis CRISPR screen of venetoclax response-associated genes identifies transcription factor ZNF740 as a key functional regulator
|











