Tested Applications
| Positive WB detected in | RAW 264.7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21583-1-AP targets ZNF75D in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16139 Product name: Recombinant human ZNF75D protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 164-233 aa of BC109100 Sequence: AEPQPMGVFQKEYWNTYRVLQEQLGWNTHKETQPVYERAVHDQQMLALSEQKRIKHWKMASKLILPESLS Predict reactive species |
| Full Name | zinc finger protein 75D |
| Calculated Molecular Weight | 510 aa, 59 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC109100 |
| Gene Symbol | ZNF75D |
| Gene ID (NCBI) | 7626 |
| RRID | AB_3085661 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P51815 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ZNF75D (zinc finger protein 75D), also known as ZNF75. It is expected to be located in nucleus and ubiquitous expression in prostate and adrenal. The calculated molecular weight of METAP1 is 60 kDa. The gene encodes a protein that likely functions as a transcription factor. ZNF75D belongs to the ZNF75 family, includes an N-terminal SCAN domain, a KRAB box, and five C2H2-type zinc finger motifs. Another functional gene belonging to this family is located on chromosome 16, while pseudogenes have been identified on chromosomes 11 and 12 (PMID: 8661144). It may be involved in transcriptional regulation.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ZNF75D antibody 21583-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



