Tested Applications
Positive WB detected in | C6 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24514-1-AP targets ZNF846 in WB, ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21687 Product name: Recombinant human ZNF846 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-55 aa of BC118657 Sequence: AFTQSTGLKLHIRTHSGEKPYKCKECGKAFTHSSYLTDHTRIHSGKKPYVCMECG Predict reactive species |
Full Name | zinc finger protein 846 |
Calculated Molecular Weight | 533 aa, 61 kDa |
Observed Molecular Weight | 62 kDa |
GenBank Accession Number | BC118657 |
Gene Symbol | ZNF846 |
Gene ID (NCBI) | 162993 |
RRID | AB_2879584 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q147U1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ZNF846 also termed as zinc finger protein 846 is a 533 amino-acid protein, which contains 1 KRAB domain and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF846 localizes in the nucleus and may play an important role in transcription regulation. The function of ZNF846 is still non-known and need to be further studied.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ZNF846 antibody 24514-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |