ZNHIT1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 87390-1-RR (same clone as 87390-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87390-1-RR (ZNHIT1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87390-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP03003-1

  The mean ZNHIT1 concentration was determined to be 12.1 ng/mL in HeLa cell extract based on a 1.2 mg/mL extract load, 13.9 ng/mL in HepG2 cell extract based on a 1.2 mg/mL extract load, 1.3 ng/mL in SKOV-3 cell extract based on a 1.1 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP03003-1

  Cytometric bead array standard curve of MP03003-1, ZNHIT1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87390-1-PBS. Detection antibody: 87390-2-PBS. Standard: Ag9741. Range: 0.625-80 ng/mL.

ZNHIT1 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 87390-1-PBS

Clone No.252815C11

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

CG1I, CGBP1, Cyclin G1 binding protein 1, Cyclin-G1-binding protein 1, p18 Hamlet

---

Product Information

87390-1-PBS targets ZNHIT1 as part of a matched antibody pair:

MP03003-1: 87390-1-PBS capture and 87390-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9741

  Product name: Recombinant human ZNHIT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-154 aa of BC017333

  Sequence: MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV

• Full Name: zinc finger, HIT type 1
• Calculated Molecular Weight: 154 aa, 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC017333
• Gene Symbol: ZNHIT1
• Gene ID (NCBI): 10467
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43257
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNHIT1(Zinc finger HIT domain containing protein 1), aslo named CGBP1 (Cyclin G1 binding protein 1), is a subunit of the SNF-2 related CBP activator protein (SRCAP) complex, which can remodel chromatin by incorporating the histone variant H2A.Z into nucleosomes(PMID: 15647280). ZNHIT1 also can bind to myogenin promoter and mediate H2A.Z incorporation for its expression(PMID: 20473270). ZNHIT1 overexpression induces apoptosis and represses proliferation and invasion of breast cancer cells(PMID: 30928405).