Tested Applications
| Positive IP detected in | HeLa cells, mouse cerebellum tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27050-1-AP targets ZRANB1 in IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25789 Product name: Recombinant human ZRANB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of AL832925 Sequence: MSERGIKWACEYCTYENWPSAIKCTMCRAQRPSGTIITEDPFKSGSSDVGRDWDPSSTEGGSSPLICPDSSARPRVKSSYSMENANKWSCHMCTYLNWPR Predict reactive species |
| Full Name | zinc finger, RAN-binding domain containing 1 |
| Calculated Molecular Weight | 81 kDa |
| Observed Molecular Weight | 81 kDa |
| GenBank Accession Number | AL832925 |
| Gene Symbol | ZRANB1 |
| Gene ID (NCBI) | 54764 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UGI0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for ZRANB1 antibody 27050-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



