Tested Applications
| Positive WB detected in | LNCaP cells, HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-Fro detected in | mouse breast cancer |
| Positive IF/ICC detected in | MCF-7 cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67784-1-Ig targets citrate synthase in WB, IHC, IF/ICC, IF-Fro, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9255 Product name: Recombinant human CS protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 132-466 aa of BC010106 Sequence: EQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSESNFARAYAQGISRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSKSG Predict reactive species |
| Full Name | citrate synthase |
| Calculated Molecular Weight | 466 aa, 52 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | BC010106 |
| Gene Symbol | Citrate Synthase |
| Gene ID (NCBI) | 1431 |
| RRID | AB_2918548 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O75390 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Citrate synthase (CS), the first and rate-limiting enzyme of the tricarboxylic acid cycle, plays a key role in regulating energy generation of mitochondrial respiration(PMID:19479947).It belongs to the citrate synthase family. The deduced 466-amino acid protein contains an N-terminal mitochondrial targeting sequence and a motif highly conserved in citrate synthases(PMID:12549038). It can exsit as a dimer(PMID:8749851). Northern blot analysis detected no CS expression in thymus and small intestine(PMID:12549038). This antibody is specific to CS.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for citrate synthase antibody 67784-1-Ig | Download protocol |
| IHC protocol for citrate synthase antibody 67784-1-Ig | Download protocol |
| WB protocol for citrate synthase antibody 67784-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Citrate synthase Monoclonal antibody (2F9G6), catalog number 67784-1-Ig, has a total of 4 citations. These appear in Cell Death Dis, J Transl Med, Aging Cell, and Cell Rep. The associated research fields include mitophagy and energy metabolism in hepatocellular carcinoma, mitochondrial bioenergetics and TCA cycle regulation in chronic heart failure, β-hydroxybutyrylation of TCA enzymes in Alzheimer's disease, and mtDNA alterations in skeletal muscle differentiation.
| Species | Application | Title |
|---|---|---|
Cell Death Dis BNIP3-mediated mitophagy boosts the competitive growth of Lenvatinib-resistant cells via energy metabolism reprogramming in HCC | ||
J Transl Med SIRT3 deficiency impairs mitochondrial bioenergetics via hyperacetylation of TCA cycle enzymes in chronic heart failure. | ||
Aging Cell Ketogenic β-hydroxybutyrate regulates β-hydroxybutyrylation of TCA cycle-associated enzymes and attenuates disease-associated pathologies in Alzheimer's mice | ||
Cell Rep mtDNA alterations in muscle progenitors determine myoblast differentiation and disrupt skeletal muscle architecture. |
Reviews
What customers say
One reviewer (Mi Huang) rated this antibody 5 out of 5 stars for Western Blot. Using a 1:1000 dilution on adipocytes (lot 00041057), they reported that it "works very well." The review was posted in February 2023 and was concise but positive, confirming reliable performance in their specific application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mi (Verified Customer) (02-21-2023) | It works very well in adipocytes.
|
