dysferlin Polyclonal antibody

• 

  WB analysis using 31658-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31658-1-AP (dysferlin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

dysferlin Polyclonal Antibody for WB, ELISA

Cat No. 31658-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

DYSF, LGMD2B, LGMD 2B, FER1L1, Fer 1 like protein 1

---

Tested Applications

• Positive WB detected in: PC-3 cells, U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31658-1-AP targets dysferlin in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35810

  Product name: Recombinant human dysferlin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 60-210 aa of NM_001130455

  Sequence: DQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDVVADTGGEEDTEDQGLTGDEAEPFLDQSGGPGAPTTPRKLPSRPPPHYPGIKRKRSAPTSR

• Full Name: dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive)
• Calculated Molecular Weight: 237 kDa
• Observed Molecular Weight: 240 kDa
• GenBank Accession Number: NM_001130455
• Gene Symbol: DYSF
• Gene ID (NCBI): 8291
• RRID: AB_3670065
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O75923
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Dysferlin, also known as FER1L1, belongs to the ferlin family and is a member of a putative muscle-specific repair complex. It has many isoforms and is a large membrane protein that is most abundant in striated muscle. It plays a role in sarcolemmal repair and is a key calcium ion sensor involved in Ca(2+)-triggered synaptic vesicle-plasma membrane fusion.