hCG Alpha Polyclonal antibody

• Home
• Products
• Primary Antibodies
• hCG Alpha Polyclonal antibody (25014-1-AP)

• 

  WB analysis using 25014-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25014-1-AP (hCG alpha antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SK-BR-3 using 25014-1-AP

  WB result of hCG Alpha antibody (25014-1-AP; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-hCG Alpha transfected SK-BR-3 cells.

• 

  WB analysis of human placenta using 25014-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 25014-1-AP (hCG alpha antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 25014-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 25014-1-AP (hCG Alpha antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 25014-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 25014-1-AP (hCG Alpha antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• KD/KO Validated

hCG Alpha Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25014-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA

Synonyms

CGA, HCG, Anterior pituitary glycoprotein hormones common subunit alpha, CG ALPHA, CG-alpha

---

Tested Applications

• Positive WB detected in: JAR cells, human placenta tissue, SK-BR-3 cells
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IHC: See 3 publications below
• IF: See 1 publications below

Product Information

25014-1-AP targets hCG Alpha in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17313

  Product name: Recombinant human CGA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-116 aa of BC020782

  Sequence: SAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

• Full Name: glycoprotein hormones, alpha polypeptide
• Calculated Molecular Weight: 116 aa, 13 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC020782
• Gene Symbol: hCG Alpha
• Gene ID (NCBI): 1081
• RRID: AB_2879846
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01215
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human chorionic gonadotropin (hCG) is a heterodimeric glycoprotein hormone consisting of two non-covalently linked subunits: a common α-subunit (hCGα) and a hormone-specific β-subunit (hCGβ) . The α-subunit, also designated CGA (chorionic gonadotropin alpha chain), is a 92-amino-acid glycopeptide of ~14-22 kDa that is identical to the α-subunits of the pituitary glycoprotein hormones luteinizing hormone (LH), follicle-stimulating hormone (FSH), and thyroid-stimulating hormone (TSH). Because the α-subunit is shared among these hormones, its biological specificity is conferred by the unique β-subunit with which it associates.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	J Immunother Cancer; TSH-TSHR axis promotes tumor immune evasion.; Authors - Zhenghao Wu
human	IHC	J Clin Endocrinol Metab; A Patient with a Thyrotropin-secreting Microadenoma and Resistance to Thyroid Hormone (P453T).; Authors - Xiaochun Teng
	WB	Eur J Pharm Sci; Transplacental transfer of metformin and interaction of metformin with the uptake transporters of placental trophoblast cells; Authors - Xiaoting Gu
human	WB	iScience; L3MBTL2-mediated CGA transcriptional suppression promotes pancreatic cancer progression through modulating autophagy.; Authors - Hua Huang
human	IHC	J Biol Chem; miR-107 reverses the multidrug resistance of gastric cancer by targeting the CGA/EGFR/GATA2 positive feedback circuit; Authors - Pei Wang
human	WB	Cell Death Dis; OPRK1 drives SLC9A3R1 progression to neuroendocrine prostate cancer.; Authors - Linghui Liang