ChromoTek iST Strep-NanoTrap IP-MS Sample Preparation Kit

Kit for IP/Co-IP of Strep-tagged proteins and sample preparations for mass spectrometry (MS)
Cat No. qtak-iST

Specificity

Strep-Tag® (sequence: SAWSHPQFEK)

Applications

IP, Co-IP, MS

Type

Nanobody

Conjugate

Agarose

Strep Trap, SAWSHPQFEK-Trap, Strep-tag-Trap

Size: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

Kit for IP/Co-IP of Strep-tagged proteins and sample preparations for mass spectrometry (MS)

DescriptionThe iST HA-Trap Kit enables researchers to process Strep-tagged proteins and their interacting partners for mass spectrometry analysis by including the ChromoTek Strep-NanoTrap for IP /Co-IP of Strep-tagged proteins and the PreOmics iST buffers and cartridges required for bottom-up proteomic sample preparation. This robust method yields purified peptides while dramatically reducing contamination and sample loss. Each kit accomodates up to eight samples and includes pull-down material for 2 controls.
ApplicationsIP, Co-IP, MS
Specificity/TargetBinds specifically to the peptide sequence SAWSHPQFEK, also known as
Strep-Tag® or Strep-TagII®, fused to a protein of interest at N- or C-terminal position. In addition, this trap binds to the peptide sequence SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK, also known as
Twin-Strep-Tag®, fused to a protein of interest at N- or C-terminal position.
Binding Capacity25 ug of recombinant SAWSHPQFEK-tagged protein (~30 kDa) per 25 uL bead slurry
ConjugateAgarose beads; ~90 um (cross-linked 4% agarose beads)
TypeNanobody
ClassRecombinant
HostAlpaca
Affinity (KD)480 nM for N-terminal Strep-Tag® and 600 nM for C-terminal Strep-Tag®
Compatibility with mass spectrometryThe Strep-NanoTrap is optimized for on-bead digestion.
Storage Buffer20% ethanol
Storage ConditionShipped at ambient temperature. Upon receipt store Strep-NanoTrap at +4°C and Digest at -20°C.

Kit components

Component Description
Strep-NanoTrap Agarose8 reactions plus 2 controls
DigestEnzyme Trypsin-mix to digest proteins
Resuspend bufferProtease reconstitution buffer for enzymes
Lyse bufferDenature, reduce, and alkylate proteins
Stop solutionStop the enzymatic activity
Wash 1 bufferClean up peptides from hydrophobic contaminants
Wash 2 bufferClean up peptides from hydrophillic contaminants
Elution bufferElute peptides from the cartridge
LC-LoadLoad peptides on reversed-phase LC-MS column
CartridgesCartridge for 1 to 100 ug protein starting material
Waste TubesTube for collecting waste after washing steps
Collection TubesTube for collecting peptides after elution
AdaptersEnables placing a cartridge into a tube
CapsCap to optionally close the cartridge's bottom

||
New chat Able
正在加载,请稍候...