Product Information
60613-2-PBS targets lama3 as part of a matched antibody pair:
MP50873-1: 60613-1-PBS capture and 60613-2-PBS detection (validated in Cytometric bead array)
MP50873-3: 60613-3-PBS capture and 60613-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30144 Product name: Recombinant human lama3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1972-2110 aa of NM_198129 Sequence: EAQRMMRELRNRNFGKHLREAEADKRESQLLLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYEK Predict reactive species |
Full Name | laminin, alpha 3 |
Calculated Molecular Weight | 367 kDa |
GenBank Accession Number | NM_198129 |
Gene Symbol | LAMA3 |
Gene ID (NCBI) | 3909 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A Magarose purification |
UNIPROT ID | Q16787 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |