Product Information
68030-3-PBS targets mitoNEET,CISD1 as part of a matched antibody pair:
MP50573-1: 68030-2-PBS capture and 68030-3-PBS detection (validated in Cytometric bead array)
MP50573-2: 68030-4-PBS capture and 68030-3-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8560 Product name: Recombinant human mitoNEET,CISD1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-108 aa of BC007043 Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET Predict reactive species |
Full Name | CDGSH iron sulfur domain 1 |
Calculated Molecular Weight | 108 aa, 12 kDa |
GenBank Accession Number | BC007043 |
Gene Symbol | CISD1 |
Gene ID (NCBI) | 55847 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G Magarose purification |
UNIPROT ID | Q9NZ45 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |