p70(S6K) Polyclonal antibody

p70(S6K) Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 26587-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

p70 alpha, p70 ribosomal S6 kinase alpha, p70 S6 kinase alpha, p70 S6K, p70 S6K 1, p70 S6K alpha, p70 S6KA, p70(S6K), p70(S6K) alpha, p70S6k, P70S6K1, PS6K, Ribosomal protein S6 kinase I, RPS6KB1, S6K, S6K beta 1, S6K1, STK14A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, A549 cells
Positive IP detected inA549 cells
Positive IHC detected inhuman lung cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 3 publications below

Product Information

26587-1-AP targets p70(S6K) in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24073

Product name: Recombinant human p70(S6K) protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-74 aa of BC053365

Sequence: MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPYELGMEHCEKFEI

Predict reactive species
Full Name ribosomal protein S6 kinase, 70kDa, polypeptide 1
Calculated Molecular Weight 59 kDa
Observed Molecular Weight60-75 kDa
GenBank Accession NumberBC053365
Gene Symbol p70 S6K
Gene ID (NCBI) 6198
RRIDAB_2880565
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP23443
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RPS6KB1(Ribosomal protein S6 kinase beta-1) is also named as STK14A, p70 S6KA and belongs to the S6 kinase subfamily. RPS6KB1 is a major substrate of MTOR and acts as a crucial effector of MTOR signaling pathway. It plays a key role in cell growth and proliferation by regulating INS sensitivity, metabolism, protein synthesis, and cell cycle. RPS6KB1 may play an important role in the progression of HCC and could serve as a potential molecular target for HCC therapy (PMID:22684641). RPS6KB1 is a 70 kDa protein and has 5 isoforms with the calculated molecular mass of 51-59kDa produced by alternative initiation.

Protocols

Product Specific Protocols
IF protocol for p70(S6K) antibody 26587-1-APDownload protocol
IHC protocol for p70(S6K) antibody 26587-1-APDownload protocol
IP protocol for p70(S6K) antibody 26587-1-APDownload protocol
WB protocol for p70(S6K) antibody 26587-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
pigWB

Am J Physiol Endocrinol Metab

Prematurity blunts the feeding-induced stimulation of translation initiation signaling and protein synthesis in muscle of neonatal piglets.

Authors - Jane K Naberhuis
mouseWB

J Agric Food Chem

Selenomethionine Promotes Milk Protein and Fat Synthesis and Proliferation of Mammary Epithelial Cells through the GPR37-mTOR-S6K1 Signaling

Authors - Jinlong Zhang
humanWB

Sci Rep

Rubidium ions as a novel therapeutic approach for glioblastoma

Authors - Zairan Wang
Loading...
||
New chat Able
正在加载,请稍候...