Tested Applications
Positive WB detected in | MCF-7 cells, A549 cells |
Positive IP detected in | A549 cells |
Positive IHC detected in | human lung cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A549 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
Product Information
26587-1-AP targets p70(S6K) in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse, pig |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24073 Product name: Recombinant human p70(S6K) protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-74 aa of BC053365 Sequence: MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPYELGMEHCEKFEI Predict reactive species |
Full Name | ribosomal protein S6 kinase, 70kDa, polypeptide 1 |
Calculated Molecular Weight | 59 kDa |
Observed Molecular Weight | 60-75 kDa |
GenBank Accession Number | BC053365 |
Gene Symbol | p70 S6K |
Gene ID (NCBI) | 6198 |
RRID | AB_2880565 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P23443 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RPS6KB1(Ribosomal protein S6 kinase beta-1) is also named as STK14A, p70 S6KA and belongs to the S6 kinase subfamily. RPS6KB1 is a major substrate of MTOR and acts as a crucial effector of MTOR signaling pathway. It plays a key role in cell growth and proliferation by regulating INS sensitivity, metabolism, protein synthesis, and cell cycle. RPS6KB1 may play an important role in the progression of HCC and could serve as a potential molecular target for HCC therapy (PMID:22684641). RPS6KB1 is a 70 kDa protein and has 5 isoforms with the calculated molecular mass of 51-59kDa produced by alternative initiation.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for p70(S6K) antibody 26587-1-AP | Download protocol |
IHC protocol for p70(S6K) antibody 26587-1-AP | Download protocol |
IF protocol for p70(S6K) antibody 26587-1-AP | Download protocol |
IP protocol for p70(S6K) antibody 26587-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Am J Physiol Endocrinol Metab Prematurity blunts the feeding-induced stimulation of translation initiation signaling and protein synthesis in muscle of neonatal piglets. | ||
J Agric Food Chem Selenomethionine Promotes Milk Protein and Fat Synthesis and Proliferation of Mammary Epithelial Cells through the GPR37-mTOR-S6K1 Signaling | ||