Tested Applications
Positive ELISA detected in | Recombinant protein |
Recommended dilution
Application | Dilution |
---|---|
Enzyme-linked Immunosorbent Assay (ELISA) | ELISA : |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IP | See 1 publications below |
Product Information
28869-1-AP targets SARS-CoV-2 S protein (126-264 aa) in WB, IP, ELISA applications and shows reactivity with Virus samples.
Tested Reactivity | Virus |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30679 Product name: Recombinant virus spike protein protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 126-264 aa of NC_045512 Sequence: VVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAA Predict reactive species |
Full Name | SARS-CoV-2 Spike Protein |
Calculated Molecular Weight | 141 kDa |
GenBank Accession Number | NC_045512 |
Gene Symbol | SARS-COV-2 |
Gene ID (NCBI) | 43740568 |
RRID | AB_2881225 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Coronaviruses (CoVs) infect human and animals and cause varieties of diseases, including respiratory, enteric, renal, and neurological diseases. CoV uses its spike protein to recognize ACE2 as its receptors and mediate membrane fusion and virus entry into host cells(PMID: 32221306). Each monomer of trimeric S protein is about 180 kDa, and contains two subunits, S1 and S2,S1 recognizes and binds to host receptors, and subsequent conformational changes in S2 facilitate fusion between the viral envelope and the host cell membrane(PMID: 19198616). Although the amino acid sequences of the S-glycoprotein were found to be different between the various HCoV, the structures showed high similarity, but the best 3D structural overlap shared by SARS-CoV and SARS-CoV-2, consistent with the shared ACE2 predicted receptor (PMID: 32522207). The spike protein of CoVs can be a target for vaccine and therapeutic development (PMID: 19198616). 28869-1-AP is specific for spike protein of SARS-COV-2, that antigen region is 126-264aa.
Publications
Species | Application | Title |
---|---|---|
EBioMedicine Primate-specific BTN3A2 protects against SARS-CoV-2 infection by interacting with and reducing ACE2 | ||
ACS Appl Mater Interfaces Promoting Drug Delivery to the Brain by Modulating the Transcytosis Process across the Blood-Brain Barrier |