VWF Monoclonal antibody

VWF Monoclonal Antibody for IHC, IF-P, ELISA
Cat No. 66682-1-Ig
Clone No.3F9F3

Host / Isotype

Mouse / IgG1

Reactivity

human and More (2)

Applications

IHC, IF-P, ELISA

VWF, VWFpp, VWD, von Willebrand antigen II, F8VWF, 3F9F3

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman breast cancer tissue, human liver cancer tissue, human prostate cancer tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman breast cancer tissue

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66682-1-Ig targets VWF in IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25578

Product name: Recombinant human vwf protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 754-854 aa of

Sequence: MSSPLSHRSKRSLSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCQD

Predict reactive species
Full Name von Willebrand factor
Gene Symbol VWF
Gene ID (NCBI) 7450
RRIDAB_2882036
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP04275
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Von Willebrand factor (VWF) is a large multimeric glycoprotein found in blood plasma involved in hemostasis following vascular injury. Due to the multimeric nature of VWF, it can range in size from 500 to 20,000 kDa due to the differences in the number of subunits comprising the protein. Each subunit is approximately 250 kDa (PMID: 9759493). The biosynthesis of VWF in vivo is limited to endothelial cells (PMID: 4209883) and megakaryocytes (PMID: 2413071). VWF synthesized in endothelial cells is either released directly into the plasma via 27186a secretory pathway, or tubulized and stored in organelles unique to this cell type called Weibel-Palade bodies (PMID: 16459301). Whereas VWF synthesized in megakaryocytes is stored in the alpha granules of platelets (PMID: 2046403). The primary function of VWF is as an adhesive plasma glycoprotein, particularly factor VIII; an essential blood-clotting protein (PMID: 6982084). VWF is also important in platelet adhesion to wound sites by binding specifically to type I and type III collagen (PMID: 11098050), with larger VWF multimers being most effective (PMID: 24448155).

Protocols

Product Specific Protocols
IHC protocol for VWF antibody 66682-1-IgDownload protocol
IF protocol for VWF antibody 66682-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

J Cell Mol Med

Impact of chronic intermittent hypoxia on the long non-coding RNA and mRNA expression profiles in myocardial infarction.

Authors - Chaowei Hu
ratIF

Int J Stem Cells

Integrin α4 Positive Subpopulation in Adipose Derived Stem Cells Effectively Reduces Infarct Size through Enhanced Engraftment into Myocardial Infarction

Authors - Zihui Yuan
IF

Exp Ther Med

Biological activity of a vascular endothelial cell-hydroxyapatite orbital implant complex: An experimental study.

Authors - Weiqi Wu
mouseIF

Cell Death Dis

Association of N6-methyladenine DNA with plaque progression in atherosclerosis via myocardial infarction-associated transcripts.

Authors - Lianpin Wu
mouseIF

Inflammation

Low-Shear Stress Promotes Atherosclerosis via Inducing Endothelial Cell Pyroptosis Mediated by IKKε/STAT1/NLRP3 Pathway

Authors - Yifei Lv
rat,mouseIF

Int J Biol Sci

Metallothionein 3 Potentiates Pulmonary Artery Smooth Muscle Cell Proliferation by Promoting Zinc-MTF1-ATG5 Axis-mediated Autophagosome Formation

Authors - Tianxin Xiong

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Kenzo (Verified Customer) (01-05-2024)

This monoclonal antibody worked well for immunohistochemistry on human heart sections to stain blood vessels.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human Heart
Loading...
||
New chat Able
正在加载,请稍候...