vwf Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83854-3-PBS

  Biolayer interferometry (BLl) kinetic assay of 83854-3-PBS against Human vwf was performed. The affinity constant is 1.21 nM.

vwf Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83854-3-PBS

Clone No.240867H2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

VWF, VWFpp, F8VWF, von Willebrand antigen II, VWD

---

Product Information

83854-3-PBS targets vwf in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25578

  Product name: Recombinant human vwf protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 754-854 aa of

  Sequence: MSSPLSHRSKRSLSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCQD

• Full Name: von Willebrand factor
• Gene Symbol: VWF
• Gene ID (NCBI): 7450
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04275
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.