AIFM3 Polyclonal antibody

AIFM3 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 14778-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

EC:1.-.-.-, Apoptosis-inducing factor-like protein, Apoptosis-inducing factor 3, Apoptosis inducing factor 3, AIFL

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, U-87 MG cells
Positive IHC detected inhuman ovary tumor tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14778-1-AP targets AIFM3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6278

Product name: Recombinant human AIFM3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 355-598 aa of BC032485

Sequence: AHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVETGDMSWLTGKGS

Predict reactive species
Full Name apoptosis-inducing factor, mitochondrion-associated, 3
Calculated Molecular Weight 67 kDa
Observed Molecular Weight 67 kDa
GenBank Accession NumberBC032485
Gene Symbol AIFM3
Gene ID (NCBI) 150209
RRIDAB_2258090
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96NN9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Apoptosis-inducing factor, mitochondrion-associated 3 (AIFM3) is a mitochondrial protein/flavoenzyme and its gene is located on chromosome 22q11.21. Mature human AIFM3 protein consists of 598 amino acids with a molecular weight of 66 kDa and is predominantly localized in the mitochondria. AIFM3 is widely expressed in many tissues, and breast cancer tissues and cholangiocarcinoma tissue (PMID: 32664187).

Protocols

Product Specific Protocols
IHC protocol for AIFM3 antibody 14778-1-APDownload protocol
WB protocol for AIFM3 antibody 14778-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...