Tested Applications
Positive WB detected in | rat colon tissue, HeLa cells, HaCaT cells |
Positive IF/ICC detected in | THP-1 cells |
Positive FC (Intra) detected in | A431 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
84239-4-RR targets APOBEC3A in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag18845 Product name: Recombinant human APOBEC3A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-61 aa of BC126416 Sequence: MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKN Predict reactive species |
Full Name | apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A |
Calculated Molecular Weight | 199 aa, 23 kDa |
Observed Molecular Weight | 28 kDa |
GenBank Accession Number | BC126416 |
Gene Symbol | APOBEC3A |
Gene ID (NCBI) | 200315 |
RRID | AB_3671792 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P31941 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
APOBEC3A, also known as A3A, belongs to the cytidine and deoxycytidylate deaminase family. APOBEC3A plays a role in immunity, by restricting transmission of foreign DNA such as viruses. One mechanism of foreign DNA restriction is deamination of foreign double-stranded DNA cytidines to uridines, which leads to DNA degradation. However, other mechanisms are also thought to be involved, as anti-viral effect is not dependent on deaminase activity. APOBEC3A is expressed in several cell types, including keratinocytes and myeloid cells (PMID: 28825669). APOBEC3A has 2 isoforms with the molecular mass of 22 and 23 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for APOBEC3A antibody 84239-4-RR | Download protocol |
IF protocol for APOBEC3A antibody 84239-4-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |