APOBEC3A Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 84239-4-RR (same clone as 84239-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84239-4-RR (APOBEC3A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84239-4-PBS in a different storage buffer formulation.

• 

  IF Staining of THP-1 using 84239-4-RR (same clone as 84239-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using APOBEC3A antibody (84239-4-RR, Clone: 241529G4 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84239-4-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 84239-4-RR (same clone as 84239-4-PBS)

  1x10^6 A431 cells were intracellularly stained with 0.25 ug Apobec3a Recombinant Antibody (84239-4-RR, Clone:241529G4) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set. This data was developed using the same antibody clone with 84239-4-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP01122-2

  Cytometric bead array standard curve of MP01122-2, APOBEC3A Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 84239-1-PBS. Detection antibody: 84239-4-PBS. Standard: Ag18845. Range: 0.625-80 ng/mL.

• 

  Affinity and Kinetic Characterization of 84239-4-PBS

  Biolayer interferometry (BLl) kinetic assay of 84239-4-PBS against Human APOBEC3A was performed. The affinity constant is 0.471 nM.

• 

  Affinity and Kinetic Characterization of 84239-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84239-4-RR against Human APOBEC3A were performed. The affinity constant is 0.328 nM.

APOBEC3A Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 84239-4-PBS

Clone No.241529G4

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

241529G4, A3A, ARP3, DNA dC->dU-editing enzyme APOBEC-3A, EC:3.5.4.38

---

Product Information

84239-4-PBS targets APOBEC3A as part of a matched antibody pair:

MP01122-2: 84239-1-PBS capture and 84239-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18845

  Product name: Recombinant human APOBEC3A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-61 aa of BC126416

  Sequence: MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKN

• Full Name: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A
• Calculated Molecular Weight: 199 aa, 23 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC126416
• Gene Symbol: APOBEC3A
• Gene ID (NCBI): 200315
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P31941
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

APOBEC3A, also known as A3A, belongs to the cytidine and deoxycytidylate deaminase family. APOBEC3A plays a role in immunity, by restricting transmission of foreign DNA such as viruses. One mechanism of foreign DNA restriction is deamination of foreign double-stranded DNA cytidines to uridines, which leads to DNA degradation. However, other mechanisms are also thought to be involved, as anti-viral effect is not dependent on deaminase activity. APOBEC3A is expressed in several cell types, including keratinocytes and myeloid cells (PMID: 28825669). APOBEC3A has 2 isoforms with the molecular mass of 22 and 23 kDa.