Tested Applications
| Positive WB detected in | unboiled mouse brain tissue |
| Positive IHC detected in | mouse small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83827-3-RR targets ATP2B1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag32423 Product name: Recombinant human ATP2B1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-89 aa of NM_001001323.1 Sequence: GDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNF Predict reactive species |
| Full Name | ATPase, Ca++ transporting, plasma membrane 1 |
| Calculated Molecular Weight | 135 kDa |
| Observed Molecular Weight | 130 kDa |
| GenBank Accession Number | NM_001001323.1 |
| Gene Symbol | ATP2B1 |
| Gene ID (NCBI) | 490 |
| RRID | AB_3671411 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P20020 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ATPase plasma membrane Ca2+ transporting 1 (ATP2B1, also known as plasma membrane Ca2+ pump isoform 1; PMCA1) belongs to the family of ATP-driven calmodulin-dependent Ca2+ pumps that participate in the regulation of intracellular free Ca2+ (PMID:35358416). The ATP2B1 contents of extracellular vesicles are increased in prostate cancer treated with enzalutamide and are negatively regulated by androgen receptors (PMID:29105980). ATP2B1 plays an important role in the prognosis of cholangiocarcinoma. Furthermore, ATP2B1 plays an important role in the prognosis of cholangiocarcinoma and can be a prognostic factor for cholangiocarcinoma (PMID:35875160).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ATP2B1 antibody 83827-3-RR | Download protocol |
| WB protocol for ATP2B1 antibody 83827-3-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
