Tested Applications
| Positive WB detected in | mouse liver tissue, HepG2 cells, mouse cerebellum tissue, mouse lung tissue, rat liver tissue |
| Positive IP detected in | mouse lung tissue |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 90 publications below |
| IHC | See 13 publications below |
| IF | See 13 publications below |
Product Information
13241-1-AP targets CYP1A1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, pig samples.
| Tested Reactivity | human, mouse, pig |
| Cited Reactivity | human, mouse, rat, pig, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3990 Product name: Recombinant human CYP1A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 115-465 aa of BC023019 Sequence: ISNGQSMSFSPDSGPVWAARRRLAQNGLKSFSIASDPASSTSCYLEEHVSKEAEVLISTLQELMAGPGHFNPYRYVVVSVTNVICAICFGRRYDHNHQELLSLVNLNNNFGEVVGSGNPADFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANVQLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTVIGRSRRPRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLKGFYIPKGRCVFVNQWQINHDQKLWVNPSEFLPERFLTPDGAIDKVLSEKVIIFGMGKRKCIGETIARW Predict reactive species |
| Full Name | cytochrome P450, family 1, subfamily A, polypeptide 1 |
| Calculated Molecular Weight | 512 aa, 58 kDa |
| Observed Molecular Weight | 50-58 kDa |
| GenBank Accession Number | BC023019 |
| Gene Symbol | CYP1A1 |
| Gene ID (NCBI) | 1543 |
| RRID | AB_2877928 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P04798 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CYP1A1 antibody 13241-1-AP | Download protocol |
| IHC protocol for CYP1A1 antibody 13241-1-AP | Download protocol |
| IP protocol for CYP1A1 antibody 13241-1-AP | Download protocol |
| WB protocol for CYP1A1 antibody 13241-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Environ Int Novel fluorescent and secreted transcriptional reporters for quantifying activity of the xenobiotic sensor aryl hydrocarbon receptor (AHR) | ||
Free Radic Biol Med 5-Methoxyflavone ameliorates non-alcoholic fatty liver disease through targeting the cytochrome P450 1A1 | ||
Phytother Res Quercetin ameliorates ulcerative colitis by activating aryl hydrocarbon receptor to improve intestinal barrier integrity | ||
NPJ Regen Med Myeloid cell-associated aromatic amino acid metabolism facilitates CNS myelin regeneration | ||
Cell Rep Hypoxia-induced PRMT1 methylates HIF2β to promote breast tumorigenesis via enhancing glycolytic gene transcription | ||
Environ Pollut Regioselective hydroxylation of carbendazim by mammalian cytochrome P450: A combined experimental and computational study. |



















