Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, K-562 cells, A2780 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
86034-1-RR targets DIS3L2 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag30634 Product name: Recombinant human DIS3L2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 99-201 aa of BC036113 Sequence: VVARNRALNGDLVVVKLLPEEHWKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSEDGHGITQNVLVDGVKKLSVCVSEKG Predict reactive species |
| Full Name | DIS3 mitotic control homolog (S. cerevisiae)-like 2 |
| Observed Molecular Weight | 99 kDa |
| GenBank Accession Number | BC036113 |
| Gene Symbol | DIS3L2 |
| Gene ID (NCBI) | 129563 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8IYB7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for DIS3L2 antibody 86034-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



