Tested Applications
| Positive WB detected in | HuH-7 cells, NCI-H1299 cells, A549 cells |
| Positive IF/ICC detected in | A431 cells |
| Positive FC (Intra) detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
83264-5-RR targets EFHD2 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag35084 Product name: Recombinant human EFHD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-80 aa of BC023611 Sequence: ATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIGEPQSPSRRVF Predict reactive species |
| Full Name | EF-hand domain family, member D2 |
| Calculated Molecular Weight | 27 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC023611 |
| Gene Symbol | EFHD2 |
| Gene ID (NCBI) | 79180 |
| RRID | AB_3670935 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q96C19 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
EFHD2 also named Swiprosin-1, is a Ca2+ binding actin protein. The expression of EFHD2 is upregulated during the activation of immune cells, epithelial and endothelial cells. The expression of EFHD2 is regulated by diverse signaling pathways that are contingent upon the specific type of cells. EFHD2 consists of 240 amino-acids. Based on the composition, the predicted molecular weight was reported to be 27 KDa while the apparent molecular weight was 33 KDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for EFHD2 antibody 83264-5-RR | Download protocol |
| IF protocol for EFHD2 antibody 83264-5-RR | Download protocol |
| WB protocol for EFHD2 antibody 83264-5-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







