EFHD2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83264-5-RR (same clone as 83264-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83264-5-RR (EFHD2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83264-5-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 83264-5-RR (same clone as 83264-5-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed A431 cells using EFHD2 antibody (83264-5-RR, Clone: 240185H5 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83264-5-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 83264-5-RR (same clone as 83264-5-PBS)

  1x10^6 A431 cells were intracellularly stained with 0.25 ug EFHD2 Recombinant antibody (83264-5-RR, Clone:240185H5) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83264-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83264-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83264-5-RR against Human EFHD2 were performed. The affinity constant is 1.42 nM.

EFHD2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 83264-5-PBS

Clone No.240185H5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

240185H5, EF-hand domain-containing protein D2, Swiprosin 1, Swiprosin-1, SWS1

---

Product Information

83264-5-PBS targets EFHD2 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35084

  Product name: Recombinant human EFHD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-80 aa of BC023611

  Sequence: ATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIGEPQSPSRRVF

• Full Name: EF-hand domain family, member D2
• Calculated Molecular Weight: 27 kDa
• GenBank Accession Number: BC023611
• Gene Symbol: EFHD2
• Gene ID (NCBI): 79180
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q96C19
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.