Tested Applications
| Positive WB detected in | MG-63 cells, mouse brain tissue, NIH/3T3 cells, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
86016-1-RR targets GIRK2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag16344 Product name: Recombinant human KCNJ6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 351-423 aa of BC101547 Sequence: YNSFHETYETSTPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENESKV Predict reactive species |
| Full Name | potassium inwardly-rectifying channel, subfamily J, member 6 |
| Calculated Molecular Weight | 423 aa, 48 kDa |
| Observed Molecular Weight | 45-48 kDa |
| GenBank Accession Number | BC101547 |
| Gene Symbol | GIRK2 |
| Gene ID (NCBI) | 3763 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P48051 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GIRK2 (also known as Kir3.2), encoded by KCNJ6 gene, is a member of the G protein-coupled inwardly-rectifying potassium channel (GIRK, Kir3) family of inward rectifier potassium channels. GIRK channels are activated following stimulation of G protein-coupled receptors (PMID: 26422984). They play important roles in regulating cellular excitabilities in the heart and brain (PMID: 31043612). Mutations in KCNJ6 gene are associated with Keppen-Lubinsky Syndrome (PMID: 25620207).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for GIRK2 antibody 86016-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
