GIRK2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86016-1-RR (same clone as 86016-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86016-1-RR (KCNJ6 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86016-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86016-1-RR (same clone as 86016-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86016-1-RR (KCNJ6 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86016-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86016-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86016-1-RR against Human GIRK2 were performed. The affinity constant is 0.372 nM.

GIRK2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86016-1-PBS

Clone No.250605D1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

KCNJ6, BIR1, G protein-activated inward rectifier potassium channel 2, GIRK 2, GIRK-2

---

Product Information

86016-1-PBS targets GIRK2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16344

  Product name: Recombinant human KCNJ6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 351-423 aa of BC101547

  Sequence: YNSFHETYETSTPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENESKV

• Full Name: potassium inwardly-rectifying channel, subfamily J, member 6
• Calculated Molecular Weight: 423 aa, 48 kDa
• Observed Molecular Weight: 45-48 kDa
• GenBank Accession Number: BC101547
• Gene Symbol: GIRK2
• Gene ID (NCBI): 3763
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P48051
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GIRK2 (also known as Kir3.2), encoded by KCNJ6 gene, is a member of the G protein-coupled inwardly-rectifying potassium channel (GIRK, Kir3) family of inward rectifier potassium channels. GIRK channels are activated following stimulation of G protein-coupled receptors (PMID: 26422984). They play important roles in regulating cellular excitabilities in the heart and brain (PMID: 31043612). Mutations in KCNJ6 gene are associated with Keppen-Lubinsky Syndrome (PMID: 25620207).