Tested Applications
| Positive WB detected in | L02 cells, Daudi cells, HeLa cells, Raji cells, Ramos cells, HepG2 cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue, human lung cancer tissue |
| Positive IF/ICC detected in | Raji cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 35 publications below |
| IHC | See 14 publications below |
| IF | See 14 publications below |
Product Information
60299-1-Ig targets ICAM-1/CD54 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8309 Product name: Recombinant human ICAM-1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 181-532 aa of BC015969 Sequence: GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEIVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP Predict reactive species |
| Full Name | intercellular adhesion molecule 1 |
| Calculated Molecular Weight | 90 kDa |
| Observed Molecular Weight | 85-95 kDa |
| GenBank Accession Number | BC015969 |
| Gene Symbol | ICAM-1 |
| Gene ID (NCBI) | 3383 |
| ENSEMBL Gene ID | ENSG00000090339 |
| RRID | AB_2881414 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P05362 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Where is ICAM-1 expressed?
Intercellular Adhesion Molecule 1 (ICAM-1), also known as Cluster of Differentiation 54 (CD54) is a transmembrane glycoprotein constitutively expressed at low levels in endothelial cells, pericytes and on some lymphocytes and monocytes1. It is located at the cytoplasmic membrane, with a large extracellular region of mainly hydrophobic amino acids joined to a small transmembrane region and a cytoplasmic tail. It has a molecular weight of 75 to 115 kDa depending on the level of glycosylation.
What is the function of ICAM-1?
ICAM-1 is important in both innate and adaptive immune responses as an adhesion molecule. Although it is constitutively expressed, in the presence of pro-inflammatory cytokines such as TNFα the endothelial cells are activated and upregulate expression of ICAM-12. In blood vessels lined with endothelial cells, leukocytes that are rolling over the surface are able to bind to ICAM-1 and transmigrate through the endothelial barrier and into the tissue. The initial binding of the leukocytes to ICAM-1 causes a Ca2+ release that initiates endothelial cell contraction and weakening of the intercellular tight junctions3, 4. This protein can be used as an indicator of endothelial activation and of vascular inflammation.
What is the role of ICAM-1 in disease?
Beyond the role in the immune response, ICAM-1 has also been identified as the target of attachment for the human rhinovirus, the cause of the common cold. Binding of the virus to ICAM-1 causes the viral capsid to uncoat and leads to release of the genetic material5.
Hubbard, A. K. & Rothlein, R. Intercellular adhesion molecule-1 (ICAM-1) expression and cell signaling cascades. Free Radic. Biol. Med. 28, 1379-86 (2000).
Long, E. O. ICAM-1: getting a grip on leukocyte adhesion. J. Immunol. 186, 5021-3 (2011).
Lawson, C. & Wolf, S. ICAM-1 signaling in endothelial cells. (2009).
Lyck, R. & Enzmann, G. The physiological roles of ICAM-1 and ICAM-2 in neutrophil migration into tissues. Curr. Opin. Hematol. 22, 53-59 (2015).
Xing, L., Casasnovas, J. M. & Cheng, R. H. Structural analysis of human rhinovirus complexed with ICAM-1 reveals the dynamics of receptor-mediated virus uncoating. J. Virol. 77, 6101-7 (2003).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ICAM-1/CD54 antibody 60299-1-Ig | Download protocol |
| IHC protocol for ICAM-1/CD54 antibody 60299-1-Ig | Download protocol |
| WB protocol for ICAM-1/CD54 antibody 60299-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Gastroenterology Proteomic characterization identifies clinically relevant subgroups of gastrointestinal stromal tumors | ||
Nat Commun CDK4/6 inhibition triggers ICAM1-driven immune response and sensitizes LKB1 mutant lung cancer to immunotherapy | ||
EBioMedicine Interactions between neutrophil extracellular traps and activated platelets enhance procoagulant activity in acute stroke patients with ICA occlusion. | ||
Redox Biol Targeting mitochondria-inflammation circle by renal denervation reduces atheroprone endothelial phenotypes and atherosclerosis. | ||
Int J Biol Sci Direct targeting of sEH with alisol B alleviated the apoptosis, inflammation, and oxidative stress in cisplatin-induced acute kidney injury | ||
J Cell Biol Hematopoietic progenitors polarize in contact with bone marrow stromal cells in response to SDF1. |





























