Tested Applications
| Positive WB detected in | THP-1 cells, SH-SY5Y cells, Jurkat cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human prostate cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 25 publications below |
| IHC | See 10 publications below |
| IF | See 5 publications below |
| IP | See 1 publications below |
| ChIP | See 1 publications below |
Product Information
10547-1-AP targets IRF5 in WB, IHC, IF/ICC, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0841 Product name: Recombinant human IRF5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 173-498 aa of BC004201 Sequence: TLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ Predict reactive species |
| Full Name | interferon regulatory factor 5 |
| Calculated Molecular Weight | 56 kDa |
| Observed Molecular Weight | 56 kDa |
| GenBank Accession Number | BC004201 |
| Gene Symbol | IRF5 |
| Gene ID (NCBI) | 3663 |
| RRID | AB_2280474 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13568 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IRF5, also named as SLEB10, contians one IRF tryptophan pentad repeat DNA-binding domain and belongs to the IRF family. It is a transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection. It is activated by TLR7 or TLR8 signaling. Genetic variations in IRF5 are associated with susceptibility to inflammatory bowel disease type 14 (IBD14) and systemic lupus erythematosus type 10 (SLEB10). Alternative splice variant encoding different isoforms exist. Catalog#10547-1-AP is a rabbit polyclonal antibody raised against the C-terminal of human IRF5.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IRF5 antibody 10547-1-AP | Download protocol |
| IF protocol for IRF5 antibody 10547-1-AP | Download protocol |
| IHC protocol for IRF5 antibody 10547-1-AP | Download protocol |
| IP protocol for IRF5 antibody 10547-1-AP | Download protocol |
| WB protocol for IRF5 antibody 10547-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Early macrophage response to obesity encompasses Interferon Regulatory Factor 5 regulated mitochondrial architecture remodelling | ||
J Immunother Cancer Ccl3 enhances docetaxel chemosensitivity in breast cancer by triggering proinflammatory macrophage polarization. | ||
Am J Transplant Characterization of Transfusion-Elicited Acute Antibody-Mediated Rejection in a Rat Model of Kidney Transplantation. | ||
J Control Release PEGylation of interleukin-10 improves the pharmacokinetic profile and enhances the antifibrotic effectivity in CCl?-induced fibrogenesis in mice. | ||
Br J Pharmacol Ibuprofen and diclofenac treatments reduce proliferation of pancreatic acinar cells upon inflammatory injury and mitogenic stimulation. |





























