Tested Applications
Positive WB detected in | A549 cells, A431 cells, HepG2 cells, mouse lung tissue, Calu-1 cells, SW480 cells, rat lung tissue |
Positive IHC detected in | mouse skin tissue, human colon tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:12000 |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 17 publications below |
IHC | See 6 publications below |
IF | See 10 publications below |
Product Information
27189-1-AP targets Integrin alpha 6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, monkey, bovine, hamster |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25835 Product name: Recombinant human Integrin alpha-6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 477-690 aa of BC136456 Sequence: TPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTK Predict reactive species |
Full Name | integrin, alpha 6 |
Calculated Molecular Weight | 1073 aa, 119 kDa |
Observed Molecular Weight | 110-130 kDa |
GenBank Accession Number | BC136456 |
Gene Symbol | Integrin alpha 6 |
Gene ID (NCBI) | 3655 |
RRID | AB_2880792 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P23229 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID:19118207). Integrin alpha 6 (ITGA6, also known as CD49f or VLA-6) is a 120-kDa single-pass type 1 transmembrane glycoprotein, which combines with the beta 1 subunit (ITGB1, CD29) or beta 4 subunit (ITGB4, CD104) to form heterodimeric laminin receptors (PMID: 1976638; 2351695). Integrin alpha 6 mediates cell-to-cell and cell-to-stroma adhesion. It has also been found in many different stem cell populations and is involved in homing and connecting stem cells to their niches and regulating self-renewal mechanisms in stem cells (PMID: 28494695).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Integrin alpha 6 antibody 27189-1-AP | Download protocol |
IHC protocol for Integrin alpha 6 antibody 27189-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
ACS Appl Mater Interfaces A Novel Three-Dimensional Follicle Culture System Decreases Oxidative Stress and Promotes the Prolonged Culture of Human Granulosa Cells | ||
Cells Comparative Analysis of mRNA and miRNA Expression between Dermal Papilla Cells and Hair Matrix Cells of Hair Follicles in Yak | ||
Virulence Role of intestinal extracellular matrix-related signaling in porcine epidemic diarrhea virus infection. | ||
Stem Cell Res Ther Both Wnt signaling and epidermal stem cell-derived extracellular vesicles are involved in epidermal cell growth. | ||
J Virol Single-cell analysis of the impact of host-cell heterogeneity on infection with foot and mouth disease virus. | ||
Vascul Pharmacol Midkine mediates dysfunction of liver sinusoidal endothelial cells through integrin α4 and α6 |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Insa (Verified Customer) (03-22-2023) | Did work very well in ICC
|