Tested Applications
| Positive WB detected in | A549 cells, A431 cells, HepG2 cells, mouse lung tissue, Calu-1 cells, SW480 cells, rat lung tissue |
| Positive IHC detected in | mouse skin tissue, human colon tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27189-1-AP targets Integrin alpha 6 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, bovine, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25835 Product name: Recombinant human Integrin alpha-6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 477-690 aa of BC136456 Sequence: TPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTK Predict reactive species |
| Full Name | integrin, alpha 6 |
| Calculated Molecular Weight | 1073 aa, 119 kDa |
| Observed Molecular Weight | 110-130 kDa |
| GenBank Accession Number | BC136456 |
| Gene Symbol | Integrin alpha 6 |
| Gene ID (NCBI) | 3655 |
| RRID | AB_2880792 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23229 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID:19118207). Integrin alpha 6 (ITGA6, also known as CD49f or VLA-6) is a 120-kDa single-pass type 1 transmembrane glycoprotein, which combines with the beta 1 subunit (ITGB1, CD29) or beta 4 subunit (ITGB4, CD104) to form heterodimeric laminin receptors (PMID: 1976638; 2351695). Integrin alpha 6 mediates cell-to-cell and cell-to-stroma adhesion. It has also been found in many different stem cell populations and is involved in homing and connecting stem cells to their niches and regulating self-renewal mechanisms in stem cells (PMID: 28494695).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Integrin alpha 6 antibody 27189-1-AP | Download protocol |
| IHC protocol for Integrin alpha 6 antibody 27189-1-AP | Download protocol |
| WB protocol for Integrin alpha 6 antibody 27189-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-ITGA6 (Integrin α6) antibody, catalog number 27189-1-AP, has 41 citations published across ~39 journals including ACS Nano, Trends in Biotechnology, Theranostics, Cell Reports Medicine, Cell Death & Disease, Oncogene, Stem Cell Research & Therapy, iScience, and Communications Biology. Research fields span oncology (gastric, ovarian, breast, lung, prostate, glioblastoma, nasopharyngeal carcinoma), cell adhesion and integrin signaling, EMT and metastasis, tissue repair and regeneration, fibrosis, viral infection, reproductive biology, and dental biomaterials.
| Species | Application | Title |
|---|---|---|
ACS Nano Biomimetic Topological Micropattern Arrays Regulate the Heterogeneity of Cellular Fates in Lung Fibroblasts between Fibrosis and Invasion | ||
Trends Biotechnol A regenerative and programmable iPSC-derived platelet platform for universal drug delivery and immunotherapy. | ||
Theranostics Comprehensive exome profiling identifies ARHGEF12 mutation as a driver in gastric cancer with ovarian metastasis | ||
Cell Rep Med DDX5 super-enhancer promotes vasculogenic mimicry formation and metastasis in nasopharyngeal carcinoma by enhancing ADAM10 transcription | ||
Cell Death Dis TM4SF1 promotes esophageal squamous cell carcinoma metastasis by interacting with integrin α6. | ||
Phytomedicine Proteomics reveals the pharmacological mechanism of flavonoids from Astragali Complanati Semen in preventing chronic liver injury |
Reviews
What customers say
The product received a single 5-star review from Insa Hirschberg (March 2023). The reviewer used the antibody at a dilution of 1:100–1:400 on iPSC-derived astrocytes for immunocytochemistry (ICC) and reported that it "did work very well." Overall, user feedback is positive, with the reviewer expressing satisfaction with the antibody's performance in their application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Insa (Verified Customer) (03-22-2023) | Did work very well in ICC
|
