• Featured Product
  • KD/KO Validated

Integrin alpha 6 Polyclonal antibody

Integrin alpha 6 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 27189-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF, ELISA

ITGA6, CD49 antigen-like family member F, CD49f, Integrin alpha-6, Integrin alpha-6 heavy chain

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, A431 cells, HepG2 cells, mouse lung tissue, Calu-1 cells, SW480 cells, rat lung tissue
Positive IHC detected inmouse skin tissue, human colon tissue, mouse colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27189-1-AP targets Integrin alpha 6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, monkey, bovine, hamster
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25835

Product name: Recombinant human Integrin alpha-6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 477-690 aa of BC136456

Sequence: TPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTK

Predict reactive species
Full Name integrin, alpha 6
Calculated Molecular Weight 1073 aa, 119 kDa
Observed Molecular Weight 110-130 kDa
GenBank Accession NumberBC136456
Gene Symbol Integrin alpha 6
Gene ID (NCBI) 3655
RRIDAB_2880792
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP23229
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID:19118207). Integrin alpha 6 (ITGA6, also known as CD49f or VLA-6) is a 120-kDa single-pass type 1 transmembrane glycoprotein, which combines with the beta 1 subunit (ITGB1, CD29) or beta 4 subunit (ITGB4, CD104) to form heterodimeric laminin receptors (PMID: 1976638; 2351695). Integrin alpha 6 mediates cell-to-cell and cell-to-stroma adhesion. It has also been found in many different stem cell populations and is involved in homing and connecting stem cells to their niches and regulating self-renewal mechanisms in stem cells (PMID: 28494695).

Protocols

Product Specific Protocols
WB protocol for Integrin alpha 6 antibody 27189-1-APDownload protocol
IHC protocol for Integrin alpha 6 antibody 27189-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

ACS Appl Mater Interfaces

A Novel Three-Dimensional Follicle Culture System Decreases Oxidative Stress and Promotes the Prolonged Culture of Human Granulosa Cells

Authors - Xinyang Zhao
bovineIF

Cells

Comparative Analysis of mRNA and miRNA Expression between Dermal Papilla Cells and Hair Matrix Cells of Hair Follicles in Yak

Authors - Xiaolan Zhang
monkeyWB

Virulence

Role of intestinal extracellular matrix-related signaling in porcine epidemic diarrhea virus infection.

Authors - Yuchen Li
humanWB

Stem Cell Res Ther

Both Wnt signaling and epidermal stem cell-derived extracellular vesicles are involved in epidermal cell growth.

Authors - Ling Leng
HamsterIF

J Virol

Single-cell analysis of the impact of host-cell heterogeneity on infection with foot and mouth disease virus.

Authors - Xiu Xin
ratIF

Vascul Pharmacol

Midkine mediates dysfunction of liver sinusoidal endothelial cells through integrin α4 and α6

Authors - Li Wu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Insa (Verified Customer) (03-22-2023)

Did work very well in ICC

  • Applications: Other
  • Primary Antibody Dilution: 1:100-1:400
  • Cell Tissue Type: iPSC derived Astrocytes
Loading...
||
New chat Able
正在加载,请稍候...