• Featured Product
  • KD/KO Validated

NAT10 Polyclonal antibody

NAT10 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13365-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA

18S rRNA cytosine acetyltransferase, ALP, EC:2.3.1.-, KIAA1709, N acetyltransferase 10

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells, Calu-1 cells, HEK-293 cells, NIH/3T3 cells
Positive IP detected inHEK-293 cells, mouse testis tissue
Positive IHC detected inhuman ovary cancer tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inNIH/3T3 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13365-1-AP targets NAT10 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, canine, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4184

Product name: Recombinant human NAT10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 676-1025 aa of BC035558

Sequence: EAVSLLEEVITPRKDLPPLLLKLNERPAERLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDEDEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIRKVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMKLKRKK

Predict reactive species
Full Name N-acetyltransferase 10 (GCN5-related)
Calculated Molecular Weight 1025 aa, 116 kDa
Observed Molecular Weight 116 kDa
GenBank Accession NumberBC035558
Gene Symbol NAT10
Gene ID (NCBI) 55226
RRIDAB_2148944
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H0A0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NAT10 (N-acetyltransferase 10) is a nucleolar protein that is involved in regulation of telomerase activity, DNA damage response, and cytokinesis. It also plays a role in maintaining nuclear shape. Inhibition of NAT10 has been reported to rescue the misshapen nuclei in laminopathic cells via microtubule reorganization. NAT10 is the first enzyme to be found to catalyze ac4C production in eukaryotic RNA and has acetyltransferase activity and RNA-binding activity. (PMID: 23592795). NAT10 is the singular human enzyme to have both acetyltransferase and RNA binding activities (PMID: 30449621). NAT10 is associated with U3 small nucleolar RNA and acetylates upstream binding factors to activate rRNA transcription (PMID: 21177859). NAT10 promoted cisplatin chemoresistance in bladder cancer cells by enhancing DNA damage repair (DDR) (PMID: 36939377). NAT10 is a vital member of the Gcn5-related N-acetyltransferase (GNAT) family and contains 1,025 amino acids with a molecular weight of 116 kDa (PMID: 37128278). NAT10 is commonly expressed in lymphoid tissue, kidney, liver, cerebellum, cerebral cortex, and the central nervous system during the embryonic period. Normal tissue cells express NAT10 in the nucleus, while tumor cells translocate NAT10 to the cytoplasm, nucleoplasm, and nuclear membrane, affecting tumor formation (PMID: 37128278). The specificity of this antibody has been tested by siRNA. (24786082)

Protocols

Product Specific Protocols
WB protocol for NAT10 antibody 13365-1-APDownload protocol
IHC protocol for NAT10 antibody 13365-1-APDownload protocol
IF protocol for NAT10 antibody 13365-1-APDownload protocol
IP protocol for NAT10 antibody 13365-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IP

Cell

Acetylation of Cytidine in mRNA Promotes Translation Efficiency.

Authors - Daniel Arango
  • KO Validated
humanWB,IF

Science

Chemical inhibition of NAT10 corrects defects of laminopathic cells.

Authors - Delphine Larrieu
  • KD Validated
humanWB,IP

Nat Commun

N-acetyltransferase 10 is implicated in the pathogenesis of cycling T cell-mediated autoimmune and inflammatory disorders in mice

Authors - Wen-Ping Li
humanWB

Cell Host Microbe

Acetylation of Cytidine Residues Boosts HIV-1 Gene Expression by Increasing Viral RNA Stability.

Authors - Kevin Tsai
  • KO Validated
humanWB

Mol Cell

Direct epitranscriptomic regulation of mammalian translation initiation through N4-acetylcytidine.

Authors - Daniel Arango
canineWB

Nucleic Acids Res

N4-acetylcytidine coordinates with NP1 and CPSF5 to facilitate alternative RNA processing during the replication of minute virus of canines

Authors - Xueyan Zhang
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

SONAM (Verified Customer) (12-18-2023)

Antibody works really well. No Nonspecific bindings.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: cancer cellls
FH

Mattia (Verified Customer) (09-12-2019)

Clear band at the right size, when antibody used at 1:1500 dilution in 5% milk an incubated at 2hrs at 25C. Band is a bit streaky, may require further optimisation.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1500
  • Cell Tissue Type: HeLa, HEK293T
FH

Jonathan (Verified Customer) (11-29-2018)

  • Applications: Western Blot, Immunofluorescence,
Loading...