Filter: AllWBIPIHCIF/ICC

WB analysis using 12303-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 12303-1-AP (PDCD6 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
WB analysis of Jurkat using 12303-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 12303-1-AP (PDCD6 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis using 12303-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 12303-1-AP (PDCD6 antibody) at dilution of 1:2000 incubated at 4 degree celsius over night.
IP experiment of HeLa using 12303-1-AP
IP result of anti-PDCD6 (IP:12303-1-AP, 3ug; Detection:12303-1-AP 1:500) with HeLa cells lysate 3200ug.
IHC staining of human lung cancer using 12303-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12303-1-AP (PDCD6 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human lung cancer using 12303-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12303-1-AP (PDCD6 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human stomach using 12303-1-AP
Immunohistochemical analysis of paraffin-embedded normal stomach slide using 12303-1-AP (PDCD6 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver cancer using 12303-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12303-1-AP (PDCD6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver cancer using 12303-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12303-1-AP (PDCD6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human stomach using 12303-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 12303-1-AP (PDCD6 Antibody) at dilution of 1:200 (under 10x lens).
IHC staining of human stomach using 12303-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 12303-1-AP (PDCD6 Antibody) at dilution of 1:200 (under 40x lens).
IF Staining of HeLa using 12303-1-AP
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PDCD6/ALG2 antibody (12303-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).
IF Staining of MDCK using 12303-1-AP
Immunofluorescent analysis of (-20°C Methanol) fixed MDCK cells using PDCD6/ALG2 antibody (12303-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

Featured Product
KD/KO Validated

PDCD6/ALG2 Polyclonal antibody

PDCD6/ALG2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12303-1-AP

Publications(22)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

ALG2, PDCD6, ALG 2, ALG-2, Apoptosis-linked gene 2 protein homolog

Formulation: PBS and Azide

PBS and Azide

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (22)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HEK-293 cells, Jurkat cells, HeLa cells, HepG2 cells, K-562 cells, NIH/3T3 cells, mouse liver tissue, rat liver tissue
Positive IP detected in	HeLa cells
Positive IHC detected in	human lung cancer tissue, human liver cancer tissue, human stomach tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	MDCK cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:8000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 5 publications below
WB	See 17 publications below
IHC	See 2 publications below
IF	See 8 publications below
IP	See 1 publications below

Product Information

12303-1-AP targets PDCD6/ALG2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2949 Product name: Recombinant human PDCD6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-191 aa of BC012384 Sequence: MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV Predict reactive species
Full Name	programmed cell death 6
Calculated Molecular Weight	191 aa, 22 kDa
Observed Molecular Weight	15-22 kDa
GenBank Accession Number	BC012384
Gene Symbol	PDCD6
Gene ID (NCBI)	10016
RRID	AB_2162459
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O75340
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Programmed cell death protein 6 (PDCD6) is also named as ALG2. PDCD6 is an evolutionarily conserved Ca2+-binding protein. PDCD6 is required for coat protein complex II-dependent endoplasmic reticulum-to-Golgi apparatus vesicular transport in the cytoplasm (PMID: 39934130). PDCD6 is involved in regulating multifaceted and pleiotropic cellular processes in different cellular compartments. The nuclear PDCD6 regulates apoptosis and alternative splicing. And cytoplasmic PDCD6 is involved in the regulation of cytoskeletal dynamics and innate immune responses. Additionally, membranous PDCD6 participates in membrane repair through endosomal sorting complex required for transport complex-dependent membrane budding. (PMID: 38436472). PDCD6 also acts as a regulator of cytosolic DNA-induced immune responses by modulating STING transport (PMID: 34787301).

Protocols

Product Specific Protocols
WB protocol for PDCD6/ALG2 antibody 12303-1-AP	Download protocol
IHC protocol for PDCD6/ALG2 antibody 12303-1-AP	Download protocol
IF protocol for PDCD6/ALG2 antibody 12303-1-AP	Download protocol
IP protocol for PDCD6/ALG2 antibody 12303-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	Nature Structural basis for dimerization quality control. Authors - Elijah L Mena View Article
human	IF	Science Triggered recruitment of ESCRT machinery promotes endolysosomal repair. Authors - Michael L Skowyra View Article
human	WB,IF	Cell Regulation of the CUL3 Ubiquitin Ligase by a Calcium-Dependent Co-adaptor. Authors - Colleen A McGourty KD Validated View Article
human	WB	Mol Cell Co-adaptor driven assembly of a CUL3 E3 ligase complex. Authors - David Akopian View Article
human	WB,IF	Cell Rep Calcium-dependent ESCRT recruitment and lysosome exocytosis maintain epithelial integrity during Candida albicans invasion. Authors - Johannes Westman KD Validated View Article
human	IF	J Cell Biol Giant worm-shaped ESCRT scaffolds surround actin-independent integrin clusters Authors - Femmy C Stempels View Article

Reviews

Add a review

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

Kristal (Verified Customer) (06-09-2025)

The PDCD6/ALG2 staining was not reaching all the cells. I am trying to use highly polarized MDCK cells. This specific antibody might not work well in MDCK cells. I fixed in 4% PFA and incubated in primary overnight with 0.1% Triton-X and 5% BSA.