Tested Applications
| Positive WB detected in | HEK-293 cells, THP-1 cells, mouse kidney tissue, rat kidney tissue, mouse brain tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
85960-1-RR targets SLC22A15 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag14547 Product name: Recombinant human SLC22A15 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 431-535 aa of BC026358 Sequence: RVGGIIAPFIPSLKYVQWSLPFIVFGATGLTSGLLSLLLPETLNSPLLETFSDLQVYSYRRLGEEALSLQALDPQQCVDKESSLGSESEEEEEFYDADEETQMIK Predict reactive species |
| Full Name | solute carrier family 22, member 15 |
| Calculated Molecular Weight | 535aa,59 kDa; 547aa,61 kDa |
| Observed Molecular Weight | 61-66 kDa |
| GenBank Accession Number | BC026358 |
| Gene Symbol | SLC22A15 |
| Gene ID (NCBI) | 55356 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8IZD6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SLC22A15 antibody 85960-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



