SLC22A15 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85960-1-RR (same clone as 85960-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85960-1-RR (SLC22A15 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85960-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85960-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85960-1-RR against Human SLC22A15 were performed. The affinity constant is 5.00 nM.

SLC22A15 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85960-1-PBS

Clone No.250347G3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Flipt 1, FLIPT1, Fly-like putative transporter 1, PRO34686, UNQ9429/PRO34686

---

Product Information

85960-1-PBS targets SLC22A15 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14547

  Product name: Recombinant human SLC22A15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 431-535 aa of BC026358

  Sequence: RVGGIIAPFIPSLKYVQWSLPFIVFGATGLTSGLLSLLLPETLNSPLLETFSDLQVYSYRRLGEEALSLQALDPQQCVDKESSLGSESEEEEEFYDADEETQMIK

• Full Name: solute carrier family 22, member 15
• Calculated Molecular Weight: 535aa,59 kDa; 547aa,61 kDa
• Observed Molecular Weight: 61-66 kDa
• GenBank Accession Number: BC026358
• Gene Symbol: SLC22A15
• Gene ID (NCBI): 55356
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IZD6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.