Tested Applications
| Positive WB detected in | HEK-293 cells, MCF-7 cells, A431 cells, A549 cells, HeLa cells, HCT 116 cells, U2OS cells |
| Positive IF/ICC detected in | MCF-7 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84102-5-RR targets TSEN34 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag35120 Product name: Recombinant human TSEN34 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 52-165 aa of BC020805 Sequence: LMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSALAAEARETRRQELLEKITEGQAAKKQKLEQASGASSSQEAGSSQAAKEDETSDGQASGEQEEAGPS Predict reactive species |
| Full Name | tRNA splicing endonuclease 34 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 34 kDa |
| Observed Molecular Weight | 34-36 kDa |
| GenBank Accession Number | BC020805 |
| Gene Symbol | TSEN34 |
| Gene ID (NCBI) | 79042 |
| RRID | AB_3671667 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q9BSV6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The human tRNA splicing endonuclease consists of a heterotetramer complex formed by the four TSEN proteins, which were identified by homology with their yeast counterparts. TSEN2 and TSEN34 are the catalytic subunits, which form a compound active site, whereas TSEN54 and TSEN15 are structural proteins. (PMID: 27392077)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for TSEN34 antibody 84102-5-RR | Download protocol |
| IF protocol for TSEN34 antibody 84102-5-RR | Download protocol |
| WB protocol for TSEN34 antibody 84102-5-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









