TSEN34 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84102-5-RR (same clone as 84102-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84102-5-RR (TSEN34 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84102-5-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 84102-5-RR (same clone as 84102-5-PBS)

  WB result of TSEN34 antibody (84102-5-RR; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TSEN34 transfected MCF-7 cells. This data was developed using the same antibody clone with 84102-5-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 84102-5-RR (same clone as 84102-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using TSEN34 antibody (84102-5-RR, Clone: 241155G4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84102-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 84102-5-RR (same clone as 84102-5-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug TSEN34 Recombinant antibody (84102-5-RR, Clone:241155G4) and Multi-rAb CoraLite ® Plus 647-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR005)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with 0.1% TritonX-100. This data was developed using the same antibody clone with 84102-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84102-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84102-5-RR against Human TSEN34 were performed. The affinity constant is 4.01 nM.

• Featured Product
• KD/KO Validated

TSEN34 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 84102-5-PBS

Clone No.241155G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

241155G4, EC:4.6.1.16, HsSen34, LENG5, PCH2C

---

Product Information

84102-5-PBS targets TSEN34 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35120

  Product name: Recombinant human TSEN34 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 52-165 aa of BC020805

  Sequence: LMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSALAAEARETRRQELLEKITEGQAAKKQKLEQASGASSSQEAGSSQAAKEDETSDGQASGEQEEAGPS

• Full Name: tRNA splicing endonuclease 34 homolog (S. cerevisiae)
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34-36 kDa
• GenBank Accession Number: BC020805
• Gene Symbol: TSEN34
• Gene ID (NCBI): 79042
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9BSV6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The human tRNA splicing endonuclease consists of a heterotetramer complex formed by the four TSEN proteins, which were identified by homology with their yeast counterparts. TSEN2 and TSEN34 are the catalytic subunits, which form a compound active site, whereas TSEN54 and TSEN15 are structural proteins. (PMID: 27392077)